General Information

  • ID:  hor006633
  • Uniprot ID:  P47212
  • Protein name:  Galanin message-associated peptide
  • Gene name:  Gal
  • Organism:  Mus musculus (Mouse)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  Expressed in retinal progenitor cells and retinal ganglion cells (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004966 galanin receptor activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031763 galanin receptor binding; GO:0031764 type 1 galanin receptor binding; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007399 nervous system development; GO:0007631 feeding behavior; GO:0008285 negative regulation of cell population proliferation; GO:0010737 protein kinase A signaling; GO:0019933 cAMP-mediated signaling; GO:0031943 regulation of glucocorticoid metabolic process; GO:0043065 positive regulation of apoptotic process; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0050672 negative regulation of lymphocyte proliferation; GO:0051464 positive regulation of cortisol secretion; GO:0051795 positive regulation of timing of catagen; GO:0060746 parental behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  ELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEKS
  • Length:  60(65-124)
  • Propeptide:  MARGSVILLGWLLLVVTLSATLGLGMPAKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEKS
  • Signal peptide:  MARGSVILLGWLLLVVTLS
  • Modification:  T53 Phosphoserine;T54 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1, GALR2, and GALR3 (By similarity). This small neuropeptide may regulate diverse physiologic functions including contraction of s
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Galr1, Galr2
  • Target Unid:   P56479, O88854
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P47212-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006633_AF2.pdbhor006633_ESM.pdb

Physical Information

Mass: 765703 Formula: C292H475N75O96S
Absent amino acids: CWY Common amino acids: LE
pI: 4.09 Basic residues: 6
Polar residues: 13 Hydrophobic residues: 22
Hydrophobicity: -14.17 Boman Index: -9241
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 108.83
Instability Index: 6071.17 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8982069
  • Title:  Molecular cloning and characterisation of the mouse preprogalanin gene.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  8614559
  • Title:  cDNA sequence, ligand biding, and regulation of galanin/GMAP in mouse br
  • PubMed ID:  33712461
  • Title: